PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Ote100121130071
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Lamiaceae; Nepetoideae; Ocimeae; Ocimum
Family HB-other
Protein Properties Length: 129aa    MW: 15508.7 Da    PI: 9.7973
Description HB-other family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Ote100121130071genomeOteDB-
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox43.36.3e-14353656
                                  S--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
                      Homeobox  6 tftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56
                                  +f++ q+++Le +F++  ++++e+++ LA+++gL+ +qV+ WF  rR +e+
  Ote100121130071|100121130071  3 RFQQFQIDALEVAFQERGHLTRERKAALADQTGLDVEQVTSWFNRRRKRER 53
                                  699*********************************************998 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003894.3E-7159IPR001356Homeobox domain
PROSITE profilePS5007113.896155IPR001356Homeobox domain
SuperFamilySSF466896.84E-12361IPR009057Homeodomain-like
CDDcd000863.19E-9353No hitNo description
Gene3DG3DSA:1.10.10.603.6E-13353IPR009057Homeodomain-like
PfamPF000463.0E-11353IPR001356Homeobox domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 129 aa     Download sequence    Send to blast
MNRFQQFQID ALEVAFQERG HLTRERKAAL ADQTGLDVEQ VTSWFNRRRK RERDGERRLM  60
SERRKSELEQ ALXXXXXXXX XXXXXXXXXX XXXXXLNDEI QKLRQQLRSF VGYDSDISDP  120
IRRFVNGYE
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA1565047